PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000162G1360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 500aa    MW: 56425.3 Da    PI: 9.8009
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000162G1360genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA37.92.5e-12350382132
             GATA   1 CsnCgttkTplWRrgp.dgnktLCnaCGlyyrk 32 
                      Cs C + +Tp+WRr++ +g+k+LCnaC l+ + 
  PH01000162G1360 350 CSRCLSNQTPQWRRDGpSGPKMLCNACALRLKA 382
                      **************766************9986 PP

2GATA53.33.8e-17432466135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  PH01000162G1360 432 CTHCMSYKTPQWRAGPLGPKTLCNACGVRFKSGRL 466
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
HamapMF_0040828.09419198IPR000814TATA-box binding protein
Gene3DG3DSA:3.30.310.105.9E-4020105IPR012295Beta2-adaptin/TBP, C-terminal domain
SuperFamilySSF559454.24E-3321114No hitNo description
CDDcd045161.91E-13122195IPR033710TATA-box binding protein, eukaryotic
PfamPF003522.8E-3224103IPR000814TATA-box binding protein
PRINTSPR006868.0E-672540IPR000814TATA-box binding protein
PRINTSPR006868.0E-674968IPR000814TATA-box binding protein
PROSITE patternPS00351052101IPR030491TATA-box binding protein, conserved site
PRINTSPR006868.0E-676886IPR000814TATA-box binding protein
Gene3DG3DSA:3.30.310.101.1E-35107196IPR012295Beta2-adaptin/TBP, C-terminal domain
PfamPF003526.2E-32112194IPR000814TATA-box binding protein
SuperFamilySSF559457.07E-30112197No hitNo description
PRINTSPR006868.0E-67115131IPR000814TATA-box binding protein
PRINTSPR006868.0E-67139154IPR000814TATA-box binding protein
PROSITE patternPS003510143192IPR030491TATA-box binding protein, conserved site
PRINTSPR006868.0E-67158174IPR000814TATA-box binding protein
SuperFamilySSF577161.47E-8343384No hitNo description
PROSITE profilePS5011411.2344381IPR000679Zinc finger, GATA-type
SMARTSM004013.1E-10344398IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.7E-11348382IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.12E-9349381No hitNo description
PfamPF003202.1E-10350382IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.121426462IPR000679Zinc finger, GATA-type
SMARTSM004012.4E-14426480IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.05E-13430490No hitNo description
Gene3DG3DSA:3.30.50.109.0E-13431464IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.11E-12431478No hitNo description
PfamPF003207.3E-15432466IPR000679Zinc finger, GATA-type
PROSITE patternPS003440432457IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006352Biological ProcessDNA-templated transcription, initiation
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MAEAVLEGSE PVDLSKHPSG IVPTLQNIVS TVNLDCKLDL KAIALQARNA EYNPKRFAAV  60
IMRIREPKTT ALIFASGKMV CTGAKSEQQS KLAARKYARI IQKLGFPAKF KDFKVQNIVG  120
SCDVKFPIRL EGLAYSHGAF SSYEPELFPG LIYRMKQPKI VLLIFVSGKI VLTGAKVRDE  180
TYTAFENIYP VLTEFRKVQQ WFHAMLLFTL QESEDGSVEW LSIYVDGCLS SSASYTNSVF  240
VEQAPTTMTN QNAAKPKLPP PSSSTSRRKK RSLASVINDD DDQHCFTLFV EPPLLLLDQK  300
HWLAESELIL PKKDKDQELV RQQEREQEED KKCKMSAGMQ FQQEQLVRRC SRCLSNQTPQ  360
WRRDGPSGPK MLCNACALRL KAGNGLTTVS KKLCGQEIDK EQEKRKRQDK KKIKKTAYVN  420
EELPPEEPVK RCTHCMSYKT PQWRAGPLGP KTLCNACGVR FKSGRLLPEY RPANSPTFVS  480
YMHSNSHKKV MQLRQAVEP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1vol_B1e-13212001200PROTEIN (TATA BINDING PROTEIN (TBP))
1vok_B1e-13212001200TATA-BOX-BINDING PROTEIN
1vok_A1e-13212001200TATA-BOX-BINDING PROTEIN
1qne_B1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qne_A1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qnc_B1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qnc_A1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qnb_B1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qnb_A1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qna_B1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qna_A1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qn9_B1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qn9_A1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qn8_B1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qn8_A1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qn7_B1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qn7_A1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qn6_B1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qn6_A1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
1qn5_B1e-13212001200TRANSCRIPTION INITIATION FACTOR TFIID-1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0930400.0FP093040.1 Phyllostachys edulis cDNA clone: bphylf027k16, full insert sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.14e-34GATA transcription factor 2